PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G3073
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 142aa    MW: 16322.5 Da    PI: 5.0098
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G3073genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.46.5e-132379561
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61
                 ++ +r+ +NRe+ArrsR RK+++++ L ++v +L++ N++  +++   ++ + +++s
  Gh_A11G3073 23 RKRKRMLSNRESARRSRMRKQKRLQDLVQEVNALQKDNSQISEKIGVATQYYIEMQS 79
                 57899*************************************999877776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.2E-161983IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.6E-112067No hitNo description
PROSITE profilePS5021710.7032167IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.27E-112377No hitNo description
PfamPF001705.2E-112380IPR004827Basic-leucine zipper domain
CDDcd147022.14E-162472No hitNo description
PROSITE patternPS0003602641IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MASLQRSASS SDSDPQYANI DERKRKRMLS NRESARRSRM RKQKRLQDLV QEVNALQKDN  60
SQISEKIGVA TQYYIEMQSA NNVLRAQAME LTERLRSLNS VLQVVEEADG YAIDIPEIPE  120
PWQLPCSIQP IMALVDMFEY DG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12243RKRKRMLSNRESARRSRMRKQK
23542RRSRMRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.97400.0boll| ovule| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490328.14e-91PREDICTED: ocs element-binding factor 1-like
SwissprotQ9LZP82e-60BZP53_ARATH; bZIP transcription factor 53
TrEMBLA0A0D2TDR42e-86A0A0D2TDR4_G
STRINGPOPTR_0002s19720.12e-62(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30362763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.15e-58basic region/leucine zipper motif 53